Splitting a peptide (splitting a long string between certain letters)

Questions
,
1

Hi guys,

I wonder is there any function in Mathematica can split a string like “MERASLIQKAKLAEQAERYEDMAAFMKGAV” , “GDYYRYLAEVETGDDKKRIIDSARSA”, and “EKKQQMAREYREKIYETELRDICNDVLSLEYKFLIPNASQ” into sub-strings between the letters “Y” and “E”. I found the documentation for string and text manipulation functions but they do not seem to work..

For example, turing XXXYEXXX, and AAAEYBBB into “XXXY”, “EXXX”, “AAAE”, and “YBBB”.

Thanks!

2

There are a thousand different ways to skin this cat:

Insert a special character between Y and E and then split the string by that character:

StringSplit[StringReplace["XXXYEXXX", {"YE" -> "Y-E", "YE" -> "Y-E"}], "-"]

Or maybe it’s best to treat this like a List instead of a String:

Split[Characters["XXXYEXXX"], Sort[{#1, #2}] != {"E", "Y"} &]

or

Map[StringJoin]@Split[Characters@"XXXYEXXX", Sort@{#1, #2} != {"E", "Y"} &]

These would be okay if you didn’t care about speed.